close

SimulationCraft 623-02

for World of Warcraft 6.2.3 Live (build level 20726)

Current simulator hotfixes

General

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-09-01 Touch of the Grave now scales its damage based on 50% of the character's Attack Power or Spell Power, whichever is greater.
Touch of the Grave (effect#1) average 0.00 8.00

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Bestial Wrath now lasts 15 seconds (up from 10 seconds).
Bestial Wrath duration 15000.00 10000.00
2015-07-20 Serpent Sting damage increased by 25%.
Serpent Sting (effect#1) ap_coefficient 0.91 0.73
2015-07-20 Black Arrow damage increased by 25%.
Black Arrow (effect#1) ap_coefficient 0.71 0.57

Item

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-11-18 Infallible Tracking Charm now has a massively increased damage and chance to trigger, but now only increases damage against demons for 5 seconds (down from 10 seconds.)
Demonbane rppm 3.00 0.96

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Dragon's Breath damage increased by 150%
Dragon's Breath (effect#1) sp_coefficient 2.15 0.86
2015-07-20 Flamestrike DOT damage increased by 50%
Flamestrike (effect#2) sp_coefficient 0.15 0.10
2015-07-20 Flamestrike impact damage increased by 50%
Flamestrike (effect#1) sp_coefficient 1.17 0.78

Paladin

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-01-30 Hammer of Wrath did not receive a 8% damage buff in 6.2.3.
Hammer of Wrath (effect#1) sp_coefficient 2.40 2.59

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Mastery: Molten Earth damage has been increased by 11%.
Molten Earth (effect#1) sp_coefficient 1.11 1.00
2015-07-20 Ascendance now has a 2-minute cooldown (down from 3 minutes) for Elemental Shaman.
Ascendance cooldown 120000.00 180000.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28
2015-07-20 Conflagrate damage increased by 5%.
Conflagrate (effect#1) sp_coefficient 2.14 2.04
2015-07-20 Shadowburn damage increased by 5%.
Shadowburn (effect#2) sp_coefficient 3.57 3.40
2015-07-20 Incinerate damage increased by 5%.
Incinerate (effect#1) sp_coefficient 1.51 1.43
2015-07-20 Immolate damage increased by 5%.
Immolate (effect#1) sp_coefficient 0.52 0.50
2015-07-20 Chaos Bolt damage increased by 5%.
Chaos Bolt (effect#1) sp_coefficient 2.39 2.28
Kautokeino

Kautokeino : 104863 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
104863.3 104863.3 91.7 / 0.087% 18109.5 / 17.3% 151.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
643.4 643.4 Mana 0.00% 39.5 100.0% 100%
Origin https://eu.api.battle.net/wow/character/stormreaver/kautokeino/advanced
Talents
  • 15: Displacer Beast
  • 30: Renewal
  • 45: Typhoon
  • 60: Incarnation: Chosen of Elune
  • 75: Ursol's Vortex
  • 90: Nature's Vigil
  • 100: Euphoria
  • Talent Calculator
Glyphs
  • Glyph of Moonwarding
  • Glyph of the Shapemender
  • Glyph of Stampeding Roar
  • Glyph of Grace
  • Glyph of Stars
  • Glyph of Untamed Stars
Professions
  • engineering: 603
  • jewelcrafting: 700

Charts

Action DPET Chart Action Damage Chart
DPS Timeline Chart Time Spent Chart

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% M-Count M-Hit M-Crit M-Crit% Up%
Kautokeino 104863
Moonfire 9360 8.9% 12.7 36.33sec 330648 278558 Direct 12.8 22522 44953 26485 17.7% 4.3 6755 13555 17.6%  
Periodic 281.4 10555 21086 12392 17.4% 93.8 3168 6331 17.5% 98.4%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 12.82 281.37 281.37 1.1870 1.5763 4209567.64 4209567.64 0.00 9178.69 278557.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 0.76 17.64% 13554.55 4943 28370 7242.79 0 28370 10239 10239 0.00
multistrike 3.53 82.36% 6754.88 2449 14185 6582.44 0 11018 23828 23828 0.00
hit 10.55 82.33% 22521.69 8091 47284 22543.31 13567 28326 237640 237640 0.00
crit 2.26 17.67% 44953.43 16202 94567 41049.53 0 90164 101800 101800 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.4 17.51% 6330.99 19 20479 6343.20 2486 11879 104029 104029 0.00
multistrike 77.4 82.49% 3167.95 6 10240 3172.26 2314 4114 245233 245233 0.00
hit 232.3 82.55% 10555.05 14 34132 10572.52 9572 12164 2451683 2451683 0.00
crit 49.1 17.45% 21085.97 13 68264 21126.59 14600 29328 1035116 1035116 0.00
 
DPS Timeline Chart
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:480.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:40.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Nithramus 9713 9.2% 4.1 120.84sec 1054574 0 Direct 4.1 1054615 0 1054615 0.0% 0.0 0 0 0.0%  

Stats details: nithramus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.12 4.12 0.00 0.00 0.0000 0.0000 4347178.72 4347178.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.12 100.00% 1054614.85 348764 2773769 1063666.27 781159 1426045 4347179 4347179 0.00
 
DPS Timeline Chart
 

Action details: nithramus

Static Values
  • id:187625
  • school:arcane
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:187625
  • name:Nithramus
  • school:arcane
  • tooltip:
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1769315.49
  • base_dd_max:1769315.49
 
Starfall 0 (8370) 0.0% (8.0%) 44.5 10.22sec 84412 0

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.52 44.52 351.94 351.94 0.0000 0.9890 0.00 0.00 0.00 10797.39 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 290.6 82.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 61.3 17.43% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Starfall (_pulse) 8370 8.0% 351.9 1.27sec 10679 0 Periodic 350.7 8294 16585 9741 17.5% 116.9 2487 4980 17.5% 0.0%

Stats details: starfall_pulse

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 351.94 0.00 0.00 350.74 0.0000 0.0000 3758300.81 3758300.81 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 20.4 17.46% 4979.57 2022 14672 4990.35 3013 8276 101660 101660 0.00
multistrike 96.5 82.54% 2486.61 1011 7336 2492.82 1897 3235 239955 239955 0.00
hit 289.5 82.54% 8294.13 3370 24454 8314.60 7230 9737 2401246 2401246 0.00
crit 61.2 17.46% 16584.88 6740 48907 16628.62 12699 22164 1015440 1015440 0.00
 
DPS Timeline Chart
 

Action details: starfall_pulse

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.296800
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Starfire 28173 26.9% 97.1 4.64sec 130419 63449 Direct 97.1 100952 201654 118576 17.5% 32.3 30295 60566 17.6%  

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.11 97.11 0.00 0.00 2.0555 0.0000 12665193.99 12665193.99 0.00 63449.38 63449.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 5.68 17.58% 60565.62 20501 153004 60512.47 0 153004 343746 343746 0.00
multistrike 26.62 82.42% 30294.60 10251 76502 30362.47 21843 44089 806284 806284 0.00
hit 80.11 82.50% 100951.88 34169 255006 101165.53 88017 121766 8087696 8087696 0.00
crit 17.00 17.50% 201653.81 68338 510012 202225.54 131156 331077 3427468 3427468 0.00
 
DPS Timeline Chart
 

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:
  • description:A Lunar spell that causes {$s1=1 + 238.1%} Arcane damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.380760
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starsurge 15619 14.9% 49.3 9.25sec 141841 118758 Direct 49.3 110025 219569 129169 17.5% 16.4 33025 65950 17.4%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.33 49.25 0.00 0.00 1.1944 0.0000 6996494.78 6996494.78 0.00 118757.76 118757.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 2.86 17.44% 65949.79 35038 147140 62234.15 0 147140 188377 188377 0.00
multistrike 13.52 82.56% 33025.35 17519 73570 33112.97 23016 53018 446464 446464 0.00
hit 40.64 82.52% 110024.82 58309 245234 110341.46 94983 131745 4471864 4471864 0.00
crit 8.61 17.48% 219568.82 122152 490468 220307.64 0 490468 1889790 1889790 0.00
 
DPS Timeline Chart
 

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:960.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=3
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:
  • description:Instantly causes {$78674s1=7929} Spellstorm damage to the target, benefiting from your strongest current Eclipse bonus. Also grants Lunar or Solar Empowerment, based on current Balance Energy side, which increases the damage of your next $164547n Starfires or $164545n Wraths by {$164545s1=30}%. Max 3 charges. Charges shared with Starfall.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.976480
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Sunfire 9843 9.4% 19.0 22.37sec 233491 190527 Direct 23.7 22413 44850 26331 17.5% 7.9 6712 13431 17.5%  
Periodic 281.0 10300 20643 12105 17.5% 93.4 3088 6171 17.5% 98.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.96 23.71 280.98 280.98 1.2255 1.5724 4426891.52 4426891.52 0.00 9519.07 190526.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 1.38 17.45% 13431.18 4963 24805 10123.37 0 24255 18599 18599 0.00
multistrike 6.55 82.55% 6712.15 2433 18520 6697.62 0 11471 43956 43956 0.00
hit 19.57 82.54% 22412.99 8072 61732 22419.73 17710 27224 438537 438537 0.00
crit 4.14 17.46% 44849.90 16157 101022 44346.48 0 101022 185645 185645 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 16.3 17.47% 6171.34 5 26737 6181.67 3007 12688 100723 100723 0.00
multistrike 77.1 82.53% 3088.17 1 13368 3094.64 2305 4159 238090 238090 0.00
hit 231.9 82.54% 10299.52 4 44561 10319.89 9280 11648 2388767 2388767 0.00
crit 49.1 17.46% 20642.67 5 89123 20687.47 13922 31698 1012575 1012575 0.00
 
DPS Timeline Chart
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1056.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every {$t2=0} seconds.
  • description:A Solar spell that burns the enemy for {$164815s1=1099} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.412340
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.297648
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Wrath 16880 16.1% 105.7 4.02sec 71818 50156 Direct 105.3 55796 111651 65540 17.4% 35.1 16737 33470 17.4%  

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.65 105.26 0.00 0.00 1.4319 0.0000 7587580.17 7587580.17 0.00 50155.87 50155.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 6.11 17.43% 33470.40 14802 86895 33432.62 0 82848 204464 204464 0.00
multistrike 28.95 82.57% 16736.77 7246 43447 16770.02 13534 22703 484463 484463 0.00
hit 86.90 82.56% 55796.45 24155 144824 55913.80 49533 66062 4848633 4848633 0.00
crit 18.36 17.44% 111650.74 48309 289649 111919.43 87574 164777 2050019 2050019 0.00
 
DPS Timeline Chart
 

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1120.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:
  • description:A Solar spell that causes {$s1=3965} Nature damage to the target.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.488240
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - fey_moonwing 9563 / 6905
Fey Missile 9563 6.6% 455.1 0.95sec 6833 4249 Direct 453.1 5313 10624 6238 17.4% 151.2 1594 3185 17.5%  

Stats details: fey_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 455.10 453.11 0.00 0.00 1.6079 0.0000 3109496.35 3109496.35 0.00 4249.33 4249.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
multistrike_crit 26.38 17.45% 3184.65 2802 5416 3185.96 2819 4056 83997 83997 0.00
multistrike 124.77 82.55% 1593.63 1401 2708 1594.26 1458 1824 198843 198843 0.00
hit 374.13 82.57% 5312.67 4670 9027 5314.64 4938 5935 1987597 1987597 0.00
crit 78.98 17.43% 10623.76 9341 18055 10626.88 9565 12016 839059 839059 0.00
 
DPS Timeline Chart
 

Action details: fey_missile

Static Values
  • id:188046
  • school:spellstorm
  • resource:none
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:0.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.600
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188046
  • name:Fey Missile
  • school:spellstorm
  • tooltip:
  • description:{$@spelldesc187875=Your Moonfire and Sunfire have a chance to summon a Faerie Dragon to assist you in battle for {$188083d=30 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.603155
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Kautokeino 0
Simple Action Stats Execute Interval
Kautokeino
Berserking 3.0 188.44sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Celestial Alignment 3.0 188.44sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.49 82.89% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.51 17.11% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: celestial_alignment

Static Values
  • id:112071
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112071
  • name:Celestial Alignment
  • school:physical
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
 
Draenic Intellect Potion (potion) 2.0 0.00sec

Stats details: draenic_intellect_potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 2.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: potion

Static Values
  • id:156426
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:156426
  • name:Draenic Intellect Potion
  • school:physical
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
 
Incarnation: Chosen of Elune (incarnation) 3.0 188.40sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.8259 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.49 82.56% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.53 17.44% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: incarnation

Static Values
  • id:102560
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases all your spell damage by an additional {$s1=15}%. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.82 82.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.18 17.60% 0.00 0 0 0.00 0 0 0 0 0.00
 
DPS Timeline Chart
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2976.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Berserking 3.0 0.0 185.4sec 188.4sec 6.64% 32.77% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 9.04% 15.56% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases haste by {$s1=30}% for all party and raid members within $a1 yards. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 3.0 0.0 185.4sec 188.4sec 9.81% 10.32% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • celestial_alignment_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Balance Energy cycle paused. All Lunar and Solar spells benefit from your maximum Eclipse bonus. Damage dealt increased by {$s2=20}%. Your Moonfire and Sunfire spells to also apply the other's damage over time effect.
  • description:You enter Celestial Alignment, a state where your Balance Energy cycle is paused, and all of your Lunar and Solar spells benefit from your maximum Eclipse bonus. Also increases your damage dealt by {$s2=20}%, and causes your Moonfire and Sunfire spells to also apply the other's damage over time effect. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:100.00%
Draenic Intellect Potion 2.0 0.0 182.4sec 0.0sec 10.85% 10.91% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_draenic_intellect_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1000.00

Stack Uptimes

  • draenic_intellect_potion_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156426
  • name:Draenic Intellect Potion
  • tooltip:Intellect increased by {$s1=1000}.
  • description:Increases your Intellect by {$s1=1000} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Faerie Blessing 3.5 29.8 119.3sec 13.1sec 93.77% 93.77% 29.8(29.8)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_faerie_blessing
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • faerie_blessing_1:93.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188086
  • name:Faerie Blessing
  • tooltip:Arcane and Nature damage increased by $w1%.
  • description:{$@spelldesc187877=When a Faerie Dragon is summoned, your Arcane and Nature damage is increased by $188086m1% for {$188086d=30 seconds}.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: Chosen of Elune (incarnation) 3.0 0.0 184.8sec 188.4sec 18.20% 18.26% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_incarnation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • incarnation_1:18.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases all your spell damage by an additional {$s1=15}%. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 27.4 0.5 16.5sec 16.6sec 52.27% 52.78% 0.5(0.6)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_lunar_empowerment
  • max_stacks:2
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_empowerment_1:20.94%
  • lunar_empowerment_2:31.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Starfire is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Starfires within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Lunar Peak 20.7 0.0 21.3sec 21.3sec 21.10% 24.16% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_lunar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lunar_peak_1:21.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171743
  • name:Lunar Peak
  • tooltip:Increases the direct damage of your next Moonfire by {$s1=100}%.
  • description:{$@spelldesc8921=A Lunar spell that burns the enemy for {$164812s1=1 + 41.2%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=20 seconds}.{$?s79577=false}[ Upon reaching 100 Lunar Energy, your next Moonfire within {$171743d=5 seconds} will deal {$171743s1=100}% additional initial damage.][]}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Mark of Bleeding Hollow 13.0 7.3 35.7sec 22.4sec 43.44% 43.48% 7.3(7.3)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_mark_of_bleeding_hollow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:500.00

Stack Uptimes

  • mark_of_bleeding_hollow_1:43.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173322
  • name:Mark of Bleeding Hollow
  • tooltip:Mastery increased by $w1.
  • description:Mastery increased by {$s1=500}.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Nithramus 4.3 0.0 120.9sec 120.8sec 14.15% 13.51% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_nithramus
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nithramus_1:14.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187616
  • name:Nithramus
  • tooltip:$?$w1>0[Damage dealt increased by $w1%. When this effect ends, the triggering ally will explode for $w1% of all damage dealt while empowered.][Contributing toward the master's Savage Hollows.]
  • description:{$@spelldesc187611=Awakens the powers of all the Savage Hallows worn by you and your allies, increasing damage dealt by ${$m1/100}% for {$187620d=15 seconds}. When this effect ends, each empowered player unleashes a blast of light that strikes all enemies within $187626A1 yards of the initiating player's location, inflicting damage equal to ${$m1/100}% of all damage they dealt while empowered. (2 min shared cooldown)}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Sign of the Dark Star 7.9 0.0 59.3sec 59.0sec 34.36% 34.41% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_sign_of_the_dark_star
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1805.00

Stack Uptimes

  • sign_of_the_dark_star_1:34.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:183924
  • name:Sign of the Dark Star
  • tooltip:Increases Intellect by {$s1=584}.
  • description:{$@spelldesc183775=Your spells and abilities have a chance to grant {$183924s1=584} Intellect for {$183924d=20 seconds}. (Approximately ${$procrppm}.2 procs per minute)}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 20.8 0.6 20.6sec 19.9sec 55.03% 56.73% 0.6(1.1)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • solar_empowerment_1:13.81%
  • solar_empowerment_2:12.85%
  • solar_empowerment_3:28.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next $n Wraths within {$d=40 seconds} by {$s1=30}%.
  • max_stacks:0
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Peak 20.2 0.0 21.3sec 21.3sec 19.48% 23.91% 0.0(0.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_solar_peak
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • solar_peak_1:19.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:171744
  • name:Solar Peak
  • tooltip:Increases the direct damage of your next Sunfire by {$s1=100}%.
  • description:{$@spelldesc93402=A Solar spell that burns the enemy for {$164815s1=1099} Nature damage and then an additional $164815o2 Nature damage over {$164815d=24 seconds}{$?s33605=false}[ to the primary target and all enemies within $164815A2 yards][]. Upon reaching 100 Solar Energy, your next Sunfire within {$171744d=5 seconds} will deal {$171744s1=100}% additional initial damage.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Starfall 13.2 31.3 35.0sec 10.3sec 77.46% 77.48% 362.0(362.0)

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • starfall_1:77.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184989
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:{$@spelldesc48505=A Lunar spell that strikes all enemies{$?s146655=true}[][ afflicted by your Moonfire or Sunfire] within $50286a yards. Deals {$50288s1=0 + 29.7%} Arcane damage every $184989t1 sec for {$184989d=10 seconds}. Max 3 charges. Charges are shared with Starsurge. Shapeshifting into an animal form or losing control of your character will cancel the effect.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
Greater Draenic Intellect Flask

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_greater_draenic_intellect_flask
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:250.00

Stack Uptimes

  • greater_draenic_intellect_flask_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:156079
  • name:Greater Draenic Intellect Flask
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=250} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
Moonkin Form

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$24905s2=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=true}[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by {$24905s2=10}% and increasing your armor by $m3%. Grants {$24907s1=550} Mastery to all party and raid members within $24907a1 yards. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
sleeper_sushi_food

Buff details

  • buff initial source:Kautokeino
  • cooldown name:buff_sleeper_sushi_food
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:125.00

Stack Uptimes

  • sleeper_sushi_food_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Kautokeino
moonfire Mana 12.8 6151.9 480.0 483.2 684.3
starfire Mana 97.1 93227.1 960.0 960.0 135.9
starsurge Mana 49.3 47353.6 960.0 960.0 147.7
sunfire Mana 23.7 25033.5 1056.0 1320.4 176.8
wrath Mana 105.6 118327.2 1120.0 1120.0 64.1
Resource Gains Type Count Total Average Overflow
energy_regen Energy 842.50 0.00 (0.00%) 0.00 5692.20 100.00%
mp5_regen Mana 842.50 289429.52 (100.00%) 343.54 795849.25 73.33%
Resource RPS-Gain RPS-Loss
Mana 641.93 643.40
Combat End Resource Mean Min Max
Mana 159348.30 157351.14 160000.00
Eclipse -14.38 -105.00 105.00
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 46.0%

Procs

Count Interval
Shooting Stars overflow (buff already up) 0.2 89.7sec
Shooting Stars 33.1 13.4sec
Starshards 44.5 10.2sec
wrong_eclipse_wrath 0.0 0.0sec
wrong_eclipse_starfire 4.5 78.5sec

Statistics & Data Analysis

Fight Length
Sample Data Kautokeino Fight Length
Count 9999
Mean 450.87
Minimum 305.85
Maximum 605.69
Spread ( max - min ) 299.84
Range [ ( max - min ) / 2 * 100% ] 33.25%
DPS
Sample Data Kautokeino Damage Per Second
Count 9999
Mean 104863.31
Minimum 91041.99
Maximum 125488.31
Spread ( max - min ) 34446.32
Range [ ( max - min ) / 2 * 100% ] 16.42%
Standard Deviation 4677.4358
5th Percentile 97459.79
95th Percentile 112945.06
( 95th Percentile - 5th Percentile ) 15485.27
Mean Distribution
Standard Deviation 46.7767
95.00% Confidence Intervall ( 104771.63 - 104954.99 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7643
0.1 Scale Factor Error with Delta=300 186766
0.05 Scale Factor Error with Delta=300 747066
0.01 Scale Factor Error with Delta=300 18676665
Distribution Chart
Priority Target DPS
Sample Data Kautokeino Priority Target Damage Per Second
Count 9999
Mean 104863.31
Minimum 91041.99
Maximum 125488.31
Spread ( max - min ) 34446.32
Range [ ( max - min ) / 2 * 100% ] 16.42%
Standard Deviation 4677.4358
5th Percentile 97459.79
95th Percentile 112945.06
( 95th Percentile - 5th Percentile ) 15485.27
Mean Distribution
Standard Deviation 46.7767
95.00% Confidence Intervall ( 104771.63 - 104954.99 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7643
0.1 Scale Factor Error with Delta=300 186766
0.05 Scale Factor Error with Delta=300 747066
0.01 Scale Factor Error with Delta=300 18676665
Distribution Chart
DPS(e)
Sample Data Kautokeino Damage Per Second (Effective)
Count 9999
Mean 104863.31
Minimum 91041.99
Maximum 125488.31
Spread ( max - min ) 34446.32
Range [ ( max - min ) / 2 * 100% ] 16.42%
Damage
Sample Data Kautokeino Damage
Count 9999
Mean 43991207.63
Minimum 34546484.17
Maximum 53786485.81
Spread ( max - min ) 19240001.65
Range [ ( max - min ) / 2 * 100% ] 21.87%
DTPS
Sample Data Kautokeino Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Kautokeino Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Kautokeino Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Kautokeino Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Kautokeino Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Kautokeino Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data KautokeinoTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Kautokeino Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=greater_draenic_intellect_flask
1 0.00 food,type=sleeper_sushi
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 moonkin_form
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=draenic_intellect
6 0.00 incarnation
7 0.00 starfire
Default action list Executed every time the actor is available.
# count action,conditions
0.00 force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
8 0.00 call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
9 4.33 use_item,slot=finger1
A 0.00 call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
B 0.00 call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
C 0.00 call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
D 0.00 call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
E 0.00 call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down
actions.single_target
# count action,conditions
F 2.41 starsurge,if=charges=3
G 19.30 starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
H 19.95 starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
I 18.87 sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
0.00 sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
0.00 stellar_flare,if=remains<7
0.00 moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
J 7.99 moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
0.00 moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
K 104.15 wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
L 78.89 starfire
actions.ca
# count action,conditions
M 7.66 starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
N 2.23 moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
O 0.05 sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
P 17.37 starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
Q 1.84 wrath,if=buff.celestial_alignment.remains>cast_time
R 2.51 moonfire,cycle_targets=1
S 0.03 sunfire,cycle_targets=1
actions.cooldowns
# count action,conditions
T 2.01 incarnation
U 1.00 potion,name=draenic_intellect
V 3.01 Berserking
W 3.01 celestial_alignment

Sample Sequence

013567VW9MNPPMPPMPPPRLLLLLKKHKKKHKILLGLLGLKKHKKKILLLGJKKKKKHILLLLLKKKHKKILGLLGJKHKKKKILLL9GLKKKKKKILLGLJKKHKKFKIFLGLLGKKKHKKKILLLTUVWMPPMNPPMPQRKKHKKKHILLLGLKKKKKKILGLLJKK9KKHKLLGLLGKIKKKKILLLGLJKKKKKILLLLKKKKHKILLLLJKKKKKILGLLGLKHKKKKILLLLJK9KKHKLTVWPPMPPNPPRLLLKKHKKKKILLGLKKKKKKILGLLLJKHKKKHILLLLKKKHKKKILGLLGJKHKKK

Sample Sequence Table

time name target resources buffs
Pre flask Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre food Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre moonkin_form Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse
Pre potion Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse draenic_intellect_potion
Pre incarnation Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse incarnation, draenic_intellect_potion
0:00.000 starfire Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 berserking Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse incarnation, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 celestial_alignment Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse berserking, incarnation, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 use_item_nithramus_the_allseer Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse berserking, incarnation, celestial_alignment, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:00.000 starsurge Fluffy_Pillow 159040.0/160000: 99% mana | 0.0/105: 0% eclipse berserking, incarnation, celestial_alignment, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:01.077 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment(2), nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:02.083 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment(2), nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:03.407 starfire Fluffy_Pillow 159056.6/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:04.729 starsurge Fluffy_Pillow 159051.1/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:05.733 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment(2), starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:07.056 starfire Fluffy_Pillow 159053.8/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment, starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:08.379 starsurge Fluffy_Pillow 159053.8/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:09.384 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.0/105: 0% eclipse bloodlust, berserking, incarnation, celestial_alignment, lunar_empowerment(2), starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:10.705 starfire Fluffy_Pillow 159047.8/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, lunar_empowerment, starfall, nithramus, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
0:12.226 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, draenic_intellect_potion
0:14.128 moonfire Fluffy_Pillow 159058.3/160000: 99% mana | 0.0/105: 0% eclipse bloodlust, incarnation, celestial_alignment, starfall, faerie_blessing, nithramus, sign_of_the_dark_star, draenic_intellect_potion
0:15.133 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 4.4/105: 4% eclipse bloodlust, incarnation, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:17.032 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 62.6/105: 60% eclipse bloodlust, incarnation, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:18.930 starfire Fluffy_Pillow 159047.8/160000: 99% mana | 99.1/105: 94% eclipse bloodlust, incarnation, starfall, faerie_blessing, sign_of_the_dark_star, draenic_intellect_potion
0:20.829 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 101.5/105: 97% eclipse bloodlust, incarnation, lunar_peak, starfall, faerie_blessing, draenic_intellect_potion
0:22.729 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 68.7/105: 65% eclipse bloodlust, incarnation, lunar_peak, faerie_blessing, draenic_intellect_potion
0:24.630 wrath Fluffy_Pillow 159055.7/160000: 99% mana | 12.2/105: 12% eclipse bloodlust, incarnation, lunar_peak, faerie_blessing
0:25.898 wrath Fluffy_Pillow 158893.1/160000: 99% mana | -29.2/105: -28% eclipse bloodlust, incarnation, faerie_blessing
0:27.165 starsurge Fluffy_Pillow 158890.5/160000: 99% mana | -66.0/105: -63% eclipse bloodlust, faerie_blessing
0:28.170 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -88.1/105: -84% eclipse bloodlust, solar_empowerment(3), starfall, faerie_blessing
0:29.184 wrath Fluffy_Pillow 158890.5/160000: 99% mana | -101.6/105: -97% eclipse bloodlust, solar_peak, solar_empowerment(2), starfall, faerie_blessing
0:30.201 wrath Fluffy_Pillow 158898.3/160000: 99% mana | -104.8/105: -100% eclipse bloodlust, solar_peak, solar_empowerment, starfall, faerie_blessing
0:31.216 starsurge Fluffy_Pillow 158893.1/160000: 99% mana | -97.4/105: -93% eclipse bloodlust, solar_peak, starfall, faerie_blessing
0:32.221 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -80.5/105: -77% eclipse bloodlust, solar_peak, solar_empowerment(3), starfall, faerie_blessing
0:33.236 sunfire Fluffy_Pillow 158893.1/160000: 99% mana | -55.3/105: -53% eclipse bloodlust, solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:34.240 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -24.8/105: -24% eclipse bloodlust, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:36.139 starfire Fluffy_Pillow 159050.5/160000: 99% mana | 36.8/105: 35% eclipse bloodlust, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:38.038 starsurge Fluffy_Pillow 159050.5/160000: 99% mana | 85.7/105: 82% eclipse bloodlust, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:39.043 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 100.3/105: 96% eclipse bloodlust, lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:40.564 starfire Fluffy_Pillow 159053.1/160000: 99% mana | 103.4/105: 98% eclipse bloodlust, lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:42.085 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 83.3/105: 79% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:43.320 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 52.9/105: 50% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:45.297 wrath Fluffy_Pillow 159054.3/160000: 99% mana | -9.8/105: -9% eclipse lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
0:46.615 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -51.0/105: -49% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
0:47.935 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -83.7/105: -80% eclipse lunar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
0:49.170 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -101.5/105: -97% eclipse lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
0:50.487 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -103.8/105: -99% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
0:51.806 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -88.5/105: -84% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing
0:53.123 sunfire Fluffy_Pillow 158887.1/160000: 99% mana | -58.4/105: -56% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
0:54.359 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -21.0/105: -20% eclipse lunar_empowerment, starfall, faerie_blessing
0:56.334 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 42.7/105: 41% eclipse starfall, faerie_blessing
0:58.801 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 97.6/105: 93% eclipse starfall, faerie_blessing
1:01.270 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 96.8/105: 92% eclipse lunar_peak, faerie_blessing
1:02.508 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 74.1/105: 71% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
1:03.745 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 40.3/105: 38% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:05.392 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -12.9/105: -12% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:07.039 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -62.8/105: -60% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:08.687 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -96.2/105: -92% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:10.332 wrath Fluffy_Pillow 158884.8/160000: 99% mana | -104.4/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
1:11.979 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -85.4/105: -81% eclipse lunar_empowerment(2), solar_peak, faerie_blessing
1:13.215 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -55.8/105: -53% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing
1:14.451 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -18.0/105: -17% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
1:16.426 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 45.5/105: 43% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
1:18.399 starfire Fluffy_Pillow 159044.8/160000: 99% mana | 92.0/105: 88% eclipse solar_empowerment(3), starfall, faerie_blessing
1:20.866 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 101.1/105: 96% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
1:23.335 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 52.5/105: 50% eclipse lunar_peak, solar_empowerment(3), faerie_blessing
1:25.802 wrath Fluffy_Pillow 159047.1/160000: 99% mana | -26.2/105: -25% eclipse solar_empowerment(3), faerie_blessing
1:27.119 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -64.8/105: -62% eclipse solar_empowerment(2), faerie_blessing
1:28.435 wrath Fluffy_Pillow 158884.8/160000: 99% mana | -92.6/105: -88% eclipse solar_empowerment, faerie_blessing
1:29.753 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -104.7/105: -100% eclipse solar_peak
1:30.987 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -100.0/105: -95% eclipse solar_peak, solar_empowerment(3), starfall
1:32.307 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -78.6/105: -75% eclipse solar_peak, solar_empowerment(2), starfall
1:33.626 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -43.9/105: -42% eclipse solar_peak, solar_empowerment, starfall, mark_of_bleeding_hollow
1:34.863 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -4.5/105: -4% eclipse solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:37.331 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 70.2/105: 67% eclipse solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:38.567 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 94.5/105: 90% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:40.543 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 103.5/105: 99% eclipse lunar_empowerment, lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:42.518 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 73.8/105: 70% eclipse lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:43.754 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 40.1/105: 38% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:44.992 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 0.3/105: 0% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:46.310 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -42.0/105: -40% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:47.546 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -75.3/105: -72% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing
1:48.863 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -98.4/105: -94% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing
1:50.182 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.8/105: -100% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing
1:51.501 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -93.5/105: -89% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
1:53.150 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -57.6/105: -55% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing
1:54.387 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -20.1/105: -19% eclipse lunar_empowerment(2), starfall, faerie_blessing
1:56.362 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 43.6/105: 41% eclipse lunar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow
1:58.337 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 91.0/105: 87% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
2:00.804 use_item_nithramus_the_allseer Fluffy_Pillow 159047.1/160000: 99% mana | 101.7/105: 97% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
2:00.804 starsurge Fluffy_Pillow 159047.1/160000: 99% mana | 101.7/105: 97% eclipse lunar_peak, faerie_blessing, nithramus, mark_of_bleeding_hollow
2:02.041 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 84.1/105: 80% eclipse lunar_empowerment(2), lunar_peak, faerie_blessing, nithramus, mark_of_bleeding_hollow
2:04.017 wrath Fluffy_Pillow 159051.9/160000: 99% mana | 31.9/105: 30% eclipse lunar_empowerment, lunar_peak, nithramus, mark_of_bleeding_hollow
2:05.665 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -21.8/105: -21% eclipse lunar_empowerment, nithramus, mark_of_bleeding_hollow
2:07.313 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -69.8/105: -66% eclipse lunar_empowerment, nithramus, mark_of_bleeding_hollow
2:08.961 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -99.5/105: -95% eclipse lunar_empowerment, faerie_blessing, nithramus, mark_of_bleeding_hollow
2:10.609 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -103.1/105: -98% eclipse lunar_empowerment, solar_peak, faerie_blessing, nithramus, mark_of_bleeding_hollow
2:12.256 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -79.7/105: -76% eclipse lunar_empowerment, solar_peak, faerie_blessing, nithramus, mark_of_bleeding_hollow
2:13.904 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -35.4/105: -34% eclipse lunar_empowerment, solar_peak, faerie_blessing, nithramus
2:15.142 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 4.7/105: 4% eclipse lunar_empowerment, faerie_blessing, nithramus
2:17.119 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 64.8/105: 62% eclipse faerie_blessing
2:19.587 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 104.1/105: 99% eclipse lunar_peak, faerie_blessing
2:20.824 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 101.5/105: 97% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
2:22.800 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 66.9/105: 64% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
2:24.038 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 31.3/105: 30% eclipse lunar_empowerment, starfall, faerie_blessing
2:25.684 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -22.4/105: -21% eclipse lunar_empowerment, starfall, faerie_blessing
2:27.333 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -70.2/105: -67% eclipse lunar_empowerment, starfall, faerie_blessing
2:28.568 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -94.6/105: -90% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
2:29.887 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.9/105: -100% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), faerie_blessing
2:31.205 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -97.6/105: -93% eclipse lunar_empowerment, solar_peak, solar_empowerment, faerie_blessing
2:32.442 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -75.6/105: -72% eclipse lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
2:33.760 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -39.9/105: -38% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing
2:35.000 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | -0.0/105: -0% eclipse lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing
2:36.235 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 39.7/105: 38% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
2:38.211 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 88.8/105: 85% eclipse solar_empowerment(3), starfall, faerie_blessing
2:39.448 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 103.4/105: 99% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing
2:41.423 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 94.7/105: 90% eclipse lunar_empowerment, lunar_peak, solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
2:43.398 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 50.6/105: 48% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:44.635 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 12.0/105: 11% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:45.955 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -31.0/105: -30% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:47.273 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -68.8/105: -65% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:48.591 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -94.9/105: -90% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:49.828 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -104.8/105: -100% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:51.146 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -98.3/105: -94% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:52.464 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -75.1/105: -72% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
2:53.781 sunfire Fluffy_Pillow 158887.1/160000: 99% mana | -39.2/105: -37% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, sign_of_the_dark_star
2:55.018 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 0.6/105: 1% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star
2:56.995 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 61.6/105: 59% eclipse lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star
2:58.969 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 99.5/105: 95% eclipse starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
3:01.438 incarnation Fluffy_Pillow 159051.9/160000: 99% mana | 94.5/105: 90% eclipse lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
3:02.675 potion Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse incarnation, lunar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
3:02.675 berserking Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse incarnation, lunar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:02.675 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse berserking, incarnation, lunar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:02.675 starsurge Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:03.751 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:05.471 starfire Fluffy_Pillow 159055.0/160000: 99% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:07.188 starsurge Fluffy_Pillow 159047.5/160000: 99% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:08.263 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:09.339 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:11.057 starfire Fluffy_Pillow 159050.0/160000: 99% mana | 70.1/105: 67% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:12.773 starsurge Fluffy_Pillow 159044.8/160000: 99% mana | 70.1/105: 67% eclipse incarnation, celestial_alignment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:14.009 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 70.1/105: 67% eclipse incarnation, celestial_alignment, lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:15.984 wrath Fluffy_Pillow 159049.5/160000: 99% mana | 70.1/105: 67% eclipse incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:17.631 moonfire Fluffy_Pillow 158889.5/160000: 99% mana | 70.1/105: 67% eclipse incarnation, celestial_alignment, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:18.868 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 36.6/105: 35% eclipse incarnation, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:20.514 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -16.9/105: -16% eclipse incarnation, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:22.162 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -66.0/105: -63% eclipse incarnation, lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:23.398 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -92.0/105: -88% eclipse incarnation, lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow, draenic_intellect_potion
3:24.717 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.6/105: -100% eclipse incarnation, lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow, draenic_intellect_potion
3:26.035 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -99.5/105: -95% eclipse incarnation, lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing, draenic_intellect_potion
3:27.354 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -77.6/105: -74% eclipse incarnation, lunar_empowerment, solar_peak, starfall, faerie_blessing, draenic_intellect_potion
3:28.592 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -44.9/105: -43% eclipse incarnation, lunar_empowerment, solar_peak, solar_empowerment(3), starfall, faerie_blessing
3:29.830 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -5.6/105: -5% eclipse incarnation, lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
3:31.808 starfire Fluffy_Pillow 159056.7/160000: 99% mana | 56.5/105: 54% eclipse solar_empowerment(3), starfall, faerie_blessing
3:34.276 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 102.3/105: 97% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
3:36.745 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 89.6/105: 85% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
3:37.980 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 62.3/105: 59% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(3), starfall, faerie_blessing
3:39.954 wrath Fluffy_Pillow 159047.1/160000: 99% mana | 1.5/105: 1% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing
3:41.273 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -40.9/105: -39% eclipse lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing
3:42.592 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -76.4/105: -73% eclipse lunar_empowerment, solar_empowerment, starfall, faerie_blessing
3:43.911 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -98.9/105: -94% eclipse lunar_empowerment, starfall, faerie_blessing
3:45.559 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -103.4/105: -98% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
3:47.207 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -80.8/105: -77% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
3:48.855 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -37.0/105: -35% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
3:50.093 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 3.1/105: 3% eclipse lunar_empowerment, faerie_blessing
3:52.067 starsurge Fluffy_Pillow 159047.1/160000: 99% mana | 63.5/105: 60% eclipse faerie_blessing
3:53.303 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 90.4/105: 86% eclipse lunar_empowerment(2), starfall, faerie_blessing
3:55.277 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 104.6/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
3:57.252 moonfire Fluffy_Pillow 159049.5/160000: 99% mana | 79.8/105: 76% eclipse lunar_peak, starfall, faerie_blessing
3:58.488 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse starfall, faerie_blessing
4:00.136 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -4.5/105: -4% eclipse starfall, faerie_blessing
4:01.785 use_item_nithramus_the_allseer Fluffy_Pillow 158894.3/160000: 99% mana | -55.8/105: -53% eclipse starfall, faerie_blessing
4:01.785 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -55.8/105: -53% eclipse starfall, faerie_blessing, nithramus
4:03.432 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -92.5/105: -88% eclipse faerie_blessing, nithramus
4:05.081 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -105.0/105: -100% eclipse solar_peak, faerie_blessing, nithramus
4:06.316 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -96.2/105: -92% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing, nithramus
4:07.635 starfire Fluffy_Pillow 158891.9/160000: 99% mana | -71.0/105: -68% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, nithramus
4:10.104 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 3.4/105: 3% eclipse solar_empowerment(2), starfall, faerie_blessing, nithramus
4:12.572 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 75.9/105: 72% eclipse solar_empowerment(2), starfall, faerie_blessing, nithramus
4:13.809 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.7/105: 93% eclipse lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing, nithramus
4:15.786 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 101.8/105: 97% eclipse lunar_empowerment, lunar_peak, solar_empowerment(2), starfall, faerie_blessing, nithramus
4:17.763 starsurge Fluffy_Pillow 159054.3/160000: 99% mana | 67.9/105: 65% eclipse lunar_peak, solar_empowerment(2), starfall, faerie_blessing
4:18.999 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 32.5/105: 31% eclipse lunar_empowerment(2), lunar_peak, solar_empowerment(2), starfall, faerie_blessing
4:20.319 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -10.5/105: -10% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
4:21.556 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -49.3/105: -47% eclipse lunar_empowerment(2), solar_empowerment, starfall, faerie_blessing
4:22.876 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -82.5/105: -79% eclipse lunar_empowerment(2), starfall, faerie_blessing
4:24.524 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -103.8/105: -99% eclipse lunar_empowerment(2), solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:26.172 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -98.0/105: -93% eclipse lunar_empowerment(2), solar_peak, faerie_blessing, mark_of_bleeding_hollow
4:27.820 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -66.4/105: -63% eclipse lunar_empowerment(2), solar_peak, faerie_blessing, mark_of_bleeding_hollow
4:29.056 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -30.7/105: -29% eclipse lunar_empowerment(2), faerie_blessing, mark_of_bleeding_hollow
4:31.032 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 33.4/105: 32% eclipse lunar_empowerment, faerie_blessing, mark_of_bleeding_hollow
4:33.007 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 85.1/105: 81% eclipse faerie_blessing, mark_of_bleeding_hollow
4:35.475 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 103.8/105: 99% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
4:36.712 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 90.2/105: 86% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:38.689 moonfire Fluffy_Pillow 159054.3/160000: 99% mana | 42.0/105: 40% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
4:39.927 wrath Fluffy_Pillow 160000.0/160000: 100% mana | 2.4/105: 2% eclipse lunar_empowerment, starfall, faerie_blessing
4:41.575 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -49.9/105: -47% eclipse lunar_empowerment, starfall, faerie_blessing
4:43.221 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -89.0/105: -85% eclipse lunar_empowerment, starfall, faerie_blessing
4:44.870 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -104.9/105: -100% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
4:46.517 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -93.3/105: -89% eclipse lunar_empowerment, solar_peak, faerie_blessing
4:48.164 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -57.3/105: -55% eclipse lunar_empowerment, solar_peak, faerie_blessing
4:49.399 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -19.7/105: -19% eclipse lunar_empowerment, faerie_blessing
4:51.374 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 43.9/105: 42% eclipse faerie_blessing
4:53.845 starfire Fluffy_Pillow 159056.7/160000: 99% mana | 98.2/105: 93% eclipse faerie_blessing
4:56.314 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 96.2/105: 92% eclipse lunar_peak, faerie_blessing
4:58.781 wrath Fluffy_Pillow 159047.1/160000: 99% mana | 39.2/105: 37% eclipse lunar_peak, faerie_blessing
5:00.428 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -14.1/105: -13% eclipse faerie_blessing
5:02.077 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -63.8/105: -61% eclipse faerie_blessing
5:03.725 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -96.7/105: -92% eclipse faerie_blessing
5:05.372 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -104.3/105: -99% eclipse solar_peak, faerie_blessing
5:06.608 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -91.9/105: -88% eclipse solar_peak, solar_empowerment(3), faerie_blessing
5:07.928 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -63.6/105: -61% eclipse solar_peak, solar_empowerment(2), faerie_blessing
5:09.165 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -27.2/105: -26% eclipse solar_empowerment(2), faerie_blessing
5:11.632 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 51.5/105: 49% eclipse solar_empowerment(2), faerie_blessing, sign_of_the_dark_star
5:14.100 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 100.8/105: 96% eclipse lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star
5:16.567 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 92.5/105: 88% eclipse lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:19.036 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 31.3/105: 30% eclipse lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:20.275 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -9.1/105: -9% eclipse solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:21.593 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -50.4/105: -48% eclipse solar_empowerment, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:22.913 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -83.2/105: -79% eclipse faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:24.561 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -104.0/105: -99% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:26.211 wrath Fluffy_Pillow 158896.7/160000: 99% mana | -97.5/105: -93% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:27.860 sunfire Fluffy_Pillow 158894.3/160000: 99% mana | -65.4/105: -62% eclipse solar_peak, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:29.097 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -29.4/105: -28% eclipse faerie_blessing, sign_of_the_dark_star
5:31.565 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 49.6/105: 47% eclipse faerie_blessing, sign_of_the_dark_star
5:32.800 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 80.9/105: 77% eclipse lunar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star
5:34.775 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 104.7/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:36.753 starsurge Fluffy_Pillow 159056.7/160000: 99% mana | 89.5/105: 85% eclipse lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:37.989 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 62.0/105: 59% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:39.965 wrath Fluffy_Pillow 159051.9/160000: 99% mana | 1.2/105: 1% eclipse lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:41.612 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -50.9/105: -49% eclipse lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:42.850 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -81.9/105: -78% eclipse lunar_empowerment, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:44.169 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -101.4/105: -97% eclipse lunar_empowerment, solar_peak, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:45.487 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -103.8/105: -99% eclipse lunar_empowerment, solar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
5:46.805 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -88.6/105: -84% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing, sign_of_the_dark_star
5:48.452 sunfire Fluffy_Pillow 158889.5/160000: 99% mana | -49.1/105: -47% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing, sign_of_the_dark_star
5:49.689 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -10.2/105: -10% eclipse lunar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star
5:51.665 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 52.5/105: 50% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
5:54.133 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 101.1/105: 96% eclipse lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
5:56.601 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 92.0/105: 88% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
5:59.069 moonfire Fluffy_Pillow 159049.5/160000: 99% mana | 30.3/105: 29% eclipse lunar_peak, faerie_blessing, mark_of_bleeding_hollow
6:00.307 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -10.1/105: -10% eclipse faerie_blessing, mark_of_bleeding_hollow
6:01.954 use_item_nithramus_the_allseer Fluffy_Pillow 158889.5/160000: 99% mana | -60.5/105: -58% eclipse faerie_blessing, mark_of_bleeding_hollow
6:01.954 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -60.5/105: -58% eclipse faerie_blessing, nithramus, mark_of_bleeding_hollow
6:03.603 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -95.0/105: -91% eclipse faerie_blessing, nithramus, mark_of_bleeding_hollow
6:05.250 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -104.7/105: -100% eclipse solar_peak, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:06.487 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -93.8/105: -89% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:07.805 starfire Fluffy_Pillow 158889.5/160000: 99% mana | -66.8/105: -64% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:10.274 incarnation Fluffy_Pillow 159051.9/160000: 99% mana | 9.0/105: 9% eclipse solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:11.511 berserking Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse incarnation, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:11.511 celestial_alignment Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse berserking, incarnation, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:11.511 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:13.660 starfire Fluffy_Pillow 159055.0/160000: 99% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:15.807 starsurge Fluffy_Pillow 159050.0/160000: 99% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, solar_empowerment(2), faerie_blessing, nithramus, mark_of_bleeding_hollow
6:16.882 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starfall, faerie_blessing, nithramus, mark_of_bleeding_hollow
6:18.600 starfire Fluffy_Pillow 159050.0/160000: 99% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, lunar_empowerment, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:20.318 moonfire Fluffy_Pillow 159050.0/160000: 99% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:21.392 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 48.0/105: 46% eclipse berserking, incarnation, celestial_alignment, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
6:23.540 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 48.0/105: 46% eclipse incarnation, celestial_alignment, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:26.009 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 48.0/105: 46% eclipse incarnation, celestial_alignment, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:27.246 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 68.1/105: 65% eclipse incarnation, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:29.716 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 104.6/105: 100% eclipse incarnation, lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:32.183 starfire Fluffy_Pillow 159047.1/160000: 99% mana | 81.3/105: 77% eclipse incarnation, lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star
6:34.651 wrath Fluffy_Pillow 159049.5/160000: 99% mana | 11.5/105: 11% eclipse incarnation, lunar_peak, solar_empowerment(2), faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:35.970 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -31.5/105: -30% eclipse incarnation, solar_empowerment, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:37.288 starsurge Fluffy_Pillow 158889.5/160000: 99% mana | -69.1/105: -66% eclipse incarnation, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:38.523 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -93.9/105: -89% eclipse incarnation, solar_empowerment(3), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:39.840 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -104.9/105: -100% eclipse incarnation, solar_peak, solar_empowerment(2), starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:41.160 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -98.1/105: -93% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:42.477 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -74.8/105: -71% eclipse solar_peak, starfall, faerie_blessing, sign_of_the_dark_star, mark_of_bleeding_hollow
6:44.123 sunfire Fluffy_Pillow 158887.1/160000: 99% mana | -28.6/105: -27% eclipse solar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
6:45.359 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 11.8/105: 11% eclipse starfall, faerie_blessing, mark_of_bleeding_hollow
6:47.829 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 81.5/105: 78% eclipse faerie_blessing, mark_of_bleeding_hollow
6:50.298 starsurge Fluffy_Pillow 159051.9/160000: 99% mana | 104.5/105: 100% eclipse lunar_peak, faerie_blessing
6:51.535 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 93.0/105: 89% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing
6:53.512 wrath Fluffy_Pillow 159054.3/160000: 99% mana | 47.3/105: 45% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
6:55.159 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -5.2/105: -5% eclipse lunar_empowerment, starfall, faerie_blessing
6:56.807 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -56.5/105: -54% eclipse lunar_empowerment, starfall, faerie_blessing
6:58.456 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -92.9/105: -88% eclipse lunar_empowerment, starfall, faerie_blessing
7:00.102 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -104.9/105: -100% eclipse lunar_empowerment, solar_peak, starfall, faerie_blessing
7:01.749 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -89.5/105: -85% eclipse lunar_empowerment, solar_peak, faerie_blessing
7:03.397 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -50.7/105: -48% eclipse lunar_empowerment, solar_peak, faerie_blessing
7:04.634 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -12.0/105: -11% eclipse lunar_empowerment, faerie_blessing
7:06.609 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 50.8/105: 48% eclipse faerie_blessing
7:07.845 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 81.8/105: 78% eclipse lunar_empowerment(2), starfall, faerie_blessing
7:09.821 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 104.8/105: 100% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
7:11.797 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 88.7/105: 84% eclipse lunar_peak, starfall, faerie_blessing
7:14.266 moonfire Fluffy_Pillow 159051.9/160000: 99% mana | 24.0/105: 23% eclipse lunar_peak, starfall, faerie_blessing
7:15.503 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -16.5/105: -16% eclipse starfall, faerie_blessing
7:17.149 starsurge Fluffy_Pillow 158887.1/160000: 99% mana | -65.6/105: -62% eclipse faerie_blessing
7:18.385 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -91.8/105: -87% eclipse solar_empowerment(3), starfall, faerie_blessing
7:19.703 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -104.5/105: -100% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
7:21.020 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -99.7/105: -95% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing
7:22.340 starsurge Fluffy_Pillow 158894.3/160000: 99% mana | -77.9/105: -74% eclipse solar_peak, starfall, faerie_blessing
7:23.576 sunfire Fluffy_Pillow 160000.0/160000: 100% mana | -45.4/105: -43% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
7:24.813 starfire Fluffy_Pillow 160000.0/160000: 100% mana | -6.2/105: -6% eclipse solar_empowerment(3), starfall, faerie_blessing
7:27.283 starfire Fluffy_Pillow 159054.3/160000: 99% mana | 69.0/105: 66% eclipse solar_empowerment(3), starfall, faerie_blessing
7:29.752 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 104.7/105: 100% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
7:32.220 starfire Fluffy_Pillow 159049.5/160000: 99% mana | 80.5/105: 77% eclipse lunar_peak, solar_empowerment(3), starfall, faerie_blessing
7:34.689 wrath Fluffy_Pillow 159051.9/160000: 99% mana | 10.2/105: 10% eclipse solar_empowerment(3), starfall, faerie_blessing
7:36.006 wrath Fluffy_Pillow 158887.1/160000: 99% mana | -32.6/105: -31% eclipse solar_empowerment(2), faerie_blessing
7:37.326 wrath Fluffy_Pillow 158894.3/160000: 99% mana | -70.1/105: -67% eclipse solar_empowerment, faerie_blessing
7:38.645 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -95.6/105: -91% eclipse faerie_blessing
7:39.883 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -104.9/105: -100% eclipse solar_peak, solar_empowerment(3), starfall, faerie_blessing
7:41.202 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -97.6/105: -93% eclipse solar_peak, solar_empowerment(2), starfall, faerie_blessing
7:42.521 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -73.8/105: -70% eclipse solar_peak, solar_empowerment, starfall, faerie_blessing
7:43.840 sunfire Fluffy_Pillow 158891.9/160000: 99% mana | -37.4/105: -36% eclipse solar_peak, starfall, faerie_blessing
7:45.079 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 2.6/105: 2% eclipse starfall, faerie_blessing
7:47.547 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 75.3/105: 72% eclipse starfall, faerie_blessing
7:48.784 starfire Fluffy_Pillow 160000.0/160000: 100% mana | 97.4/105: 93% eclipse lunar_empowerment(2), starfall, faerie_blessing
7:50.760 starfire Fluffy_Pillow 159051.9/160000: 99% mana | 102.0/105: 97% eclipse lunar_empowerment, lunar_peak, starfall, faerie_blessing
7:52.735 starsurge Fluffy_Pillow 159049.5/160000: 99% mana | 68.6/105: 65% eclipse lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
7:53.972 moonfire Fluffy_Pillow 160000.0/160000: 100% mana | 33.3/105: 32% eclipse lunar_empowerment(2), lunar_peak, starfall, faerie_blessing, mark_of_bleeding_hollow
7:55.209 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -6.9/105: -7% eclipse lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
7:56.857 starsurge Fluffy_Pillow 158891.9/160000: 99% mana | -57.8/105: -55% eclipse lunar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
7:58.093 wrath Fluffy_Pillow 160000.0/160000: 100% mana | -86.7/105: -83% eclipse lunar_empowerment(2), solar_empowerment(3), starfall, faerie_blessing, mark_of_bleeding_hollow
7:59.411 wrath Fluffy_Pillow 158889.5/160000: 99% mana | -103.2/105: -98% eclipse lunar_empowerment(2), solar_peak, solar_empowerment(2), starfall, faerie_blessing, mark_of_bleeding_hollow
8:00.730 wrath Fluffy_Pillow 158891.9/160000: 99% mana | -102.3/105: -97% eclipse lunar_empowerment(2), solar_peak, solar_empowerment, starfall, faerie_blessing, mark_of_bleeding_hollow

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 658 627 627
Agility 1350 1286 1286
Stamina 8278 7526 7526
Intellect 6294 5732 5511 (4422)
Spirit 783 783 783
Health 496680 451560 0
Mana 160000 160000 0
Eclipse 105 105 0
Spell Power 9854 8396 2664
Crit 20.45% 15.45% 1150
Haste 21.72% 15.92% 1433
Multistrike 16.68% 11.68% 771
Damage / Heal Versatility 4.75% 1.75% 228
ManaReg per Second 2379 640 0
Attack Power 1485 1286 0
Mastery 114.67% 98.60% 3458
Armor 4245 1415 1415
Run Speed 0 0 263

Gear

Source Slot Average Item Level: 736.00
Local Head Oathclaw Helm
ilevel: 735, stats: { 190 Armor, +444 AgiInt, +667 Sta, +359 Mastery, +232 Crit }, gems: { +75 Mastery }
Local Neck Glowing Firestone
ilevel: 730, stats: { +238 Int, +357 Sta, +227 Crit, +91 Mult }, enchant: { +75 Mastery }
Local Shoulders Oathclaw Mantle
ilevel: 720, stats: { 161 Armor, +290 AgiInt, +435 Sta, +251 Mastery, +135 Haste }
Local Chest Oathclaw Vestment
ilevel: 735, stats: { 234 Armor, +444 AgiInt, +667 Sta, +372 Haste, +220 Mastery }
Local Waist Belt of Misconceived Loyalty
ilevel: 735, stats: { 131 Armor, +333 AgiInt, +500 Sta, +288 Crit, +155 Mastery }
Local Legs Oathclaw Leggings
ilevel: 720, stats: { 188 Armor, +387 AgiInt, +580 Sta, +301 Mult, +213 Mastery }
Local Feet Jungle Assassin's Footpads
ilevel: 735, stats: { 161 Armor, +333 AgiInt, +500 Sta, +279 Mult, +165 Haste }
Local Wrists Manacles of the Multitudes
ilevel: 740, stats: { 105 Armor, +262 AgiInt, +393 Sta, +234 Crit, +115 Mastery, +149 RunSpeed }
Local Hands Felfinger Runegloves
ilevel: 736, stats: { 147 Armor, +337 AgiInt, +505 Sta, +320 Haste, +128 Mastery }
Local Finger1 Nithramus, the All-Seer
ilevel: 795, stats: { +437 Int, +656 Sta, +328 Mastery, +228 Vers }, enchant: { +50 Mastery }
Local Finger2 Whispering Taladite Ring of the Peerless
ilevel: 725, stats: { +342 Sta, +228 Int, +169 Crit, +122 Mastery }, enchant: { +50 Mastery }
Local Trinket1 Desecrated Shadowmoon Insignia
ilevel: 730, stats: { +525 Mastery, +182 Avoidance }
Local Trinket2 Seed of Creation
ilevel: 730, gems: { +75 Mastery }
Local Back Cloak of Hideous Unity
ilevel: 740, stats: { 98 Armor, +262 Int, +393 Sta, +249 Haste, +100 Mult }, gems: { +75 Mastery }, enchant: { +100 Mastery }
Local Main Hand Mindscythe of the Legion
ilevel: 740, weapon: { 591 - 1099, 2.6 }, stats: { +199 Int, +299 Sta, +167 Mastery, +99 Haste, +2664 SP, +114 RunSpeed }, enchant: mark_of_bleeding_hollow
Local Off Hand Thumping Demonheart Fetish
ilevel: 725, stats: { +228 Int, +342 Sta, +210 Mastery, +93 Haste }
Local Tabard Tabard of the Lightbringer
ilevel: 80

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Ysera's Gift Renewal Cenarion Ward
45 Faerie Swarm (Balance Druid) Mass Entanglement Typhoon
60 Soul of the Forest Incarnation: Chosen of Elune Force of Nature
75 Incapacitating Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil
100 Euphoria Stellar Flare Balance of Power

Profile

druid="Kautokeino"
origin="https://eu.api.battle.net/wow/character/stormreaver/kautokeino/advanced"
thumbnail="http://eu.battle.net/static-render/eu/internal-record-3656/126/123193982-avatar.jpg"
level=100
race=troll
role=spell
position=back
professions=engineering=603/jewelcrafting=700
talents=http://eu.battle.net/wow/en/tool/talent-calculator#Ua!1121120
glyphs=moonwarding/shapemender/stampeding_roar/grace/stars/untamed_stars
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=flask,type=greater_draenic_intellect_flask
actions.precombat+=/food,type=sleeper_sushi
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/moonkin_form
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=draenic_intellect
actions.precombat+=/incarnation
actions.precombat+=/starfire

# Executed every time the actor is available.

actions=force_of_nature,if=trinket.stat.intellect.up|charges=3|target.time_to_die<21
actions+=/call_action_list,name=cooldowns,if=cooldown.celestial_alignment.up&(eclipse_energy>=0|target.time_to_die<=30+gcd)
actions+=/use_item,slot=finger1
actions+=/call_action_list,name=ca_aoe,if=buff.celestial_alignment.up&spell_targets.starfall_pulse>1&!t18_class_trinket
actions+=/call_action_list,name=ca,if=buff.celestial_alignment.up&(spell_targets.starfall_pulse=1|t18_class_trinket)
actions+=/call_action_list,name=aoe_t18_trinket,if=buff.celestial_alignment.down&spell_targets.starfall.pulse>1&t18_class_trinket
actions+=/call_action_list,name=aoe,if=spell_targets.starfall_pulse>1&buff.celestial_alignment.down&!t18_class_trinket
actions+=/call_action_list,name=single_target,if=spell_targets.starfall_pulse=1&buff.celestial_alignment.down

actions.single_target=starsurge,if=charges=3
actions.single_target+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>40
actions.single_target+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<-40
actions.single_target+=/sunfire,if=!talent.balance_of_power.enabled&((remains<solar_max&eclipse_dir.solar)|(buff.solar_peak.up&buff.solar_peak.remains<action.wrath.cast_time))
actions.single_target+=/sunfire,if=talent.balance_of_power.enabled&(remains<lunar_max+10|remains<action.wrath.cast_time)
actions.single_target+=/stellar_flare,if=remains<7
actions.single_target+=/moonfire,if=!talent.euphoria.enabled&!talent.balance_of_power.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+20))
actions.single_target+=/moonfire,if=talent.euphoria.enabled&((remains<lunar_max&eclipse_dir.lunar)|(buff.lunar_peak.up&buff.lunar_peak.remains<action.starfire.cast_time&remains<eclipse_change+10))
actions.single_target+=/moonfire,if=talent.balance_of_power.enabled&(remains<solar_max+10|remains<action.starfire.cast_time)
actions.single_target+=/wrath,if=(eclipse_energy<0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.single_target+=/starfire

actions.aoe=sunfire,cycle_targets=1,if=remains<8
actions.aoe+=/starfall,if=spell_targets.starfall_pulse>2&buff.starfall.remains<3
actions.aoe+=/starfall,if=@eclipse_energy<20&eclipse_dir.lunar&buff.starfall.remains<3&talent.euphoria.enabled
actions.aoe+=/starfall,if=@eclipse_energy<10&eclipse_dir.lunar&buff.starfall.remains<3&!talent.euphoria.enabled
actions.aoe+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe+=/stellar_flare,cycle_targets=1,if=remains<7
actions.aoe+=/starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>40&charges>1)|charges=3
actions.aoe+=/starsurge,if=(buff.solar_empowerment.down&eclipse_energy<-40&charges>1)|charges=3
actions.aoe+=/wrath,if=(eclipse_energy<=0&eclipse_change>action.starfire.cast_time)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe+=/starfire

actions.ca=starsurge,if=(buff.lunar_empowerment.down&eclipse_energy>=0)|(buff.solar_empowerment.down&eclipse_energy<0)
actions.ca+=/moonfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/sunfire,cycle_targets=1,if=!dot.moonfire.remains|!dot.sunfire.remains
actions.ca+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca+=/moonfire,cycle_targets=1
actions.ca+=/sunfire,cycle_targets=1

actions.ca_aoe=starfall,if=buff.starfall.remains<3
actions.ca_aoe+=/moonfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/sunfire,cycle_targets=1,if=!dot.moonfire.ticking|!dot.sunfire.ticking
actions.ca_aoe+=/starsurge,if=buff.lunar_empowerment.down&eclipse_energy>=0&charges>1
actions.ca_aoe+=/starsurge,if=buff.solar_empowerment.down&eclipse_energy<0&charges>1
actions.ca_aoe+=/starfire,if=eclipse_energy>=0&buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/wrath,if=buff.celestial_alignment.remains>cast_time
actions.ca_aoe+=/moonfire,cycle_targets=1
actions.ca_aoe+=/sunfire,cycle_targets=1

actions.aoe_t18_trinket=starsurge,if=charges=3
actions.aoe_t18_trinket+=/sunfire,cycle_targets=1,if=remains<8
actions.aoe_t18_trinket+=/moonfire,cycle_targets=1,if=remains<12
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy>40&buff.lunar_empowerment.down
actions.aoe_t18_trinket+=/starsurge,if=eclipse_energy<-40&buff.solar_empowerment.down
actions.aoe_t18_trinket+=/wrath,if=(eclipse_energy<0&action.starfire.cast_time<eclipse_change)|(eclipse_energy>0&cast_time>eclipse_change)
actions.aoe_t18_trinket+=/starfire

actions.cooldowns=incarnation
actions.cooldowns+=/potion,name=draenic_intellect
actions.cooldowns+=/Berserking
actions.cooldowns+=/celestial_alignment

head=oathclaw_helm,id=124261,bonus_id=565/567,upgrade=2,gems=75mastery
neck=glowing_firestone,id=124211,bonus_id=567,upgrade=2,enchant=75mastery
shoulders=oathclaw_mantle,id=124272,bonus_id=566,upgrade=2
back=cloak_of_hideous_unity,id=124138,bonus_id=565/567,upgrade=2,gems=75mastery,enchant=gift_of_mastery
chest=oathclaw_vestment,id=124246,bonus_id=567,upgrade=2
tabard=tabard_of_the_lightbringer,id=52252
wrists=manacles_of_the_multitudes,id=124280,bonus_id=42/567,upgrade=2
hands=felfinger_runegloves,id=124254,bonus_id=561/566,upgrade=2
waist=belt_of_misconceived_loyalty,id=124275,bonus_id=567,upgrade=2,addon=nitro_boosts
legs=oathclaw_leggings,id=124267,bonus_id=566,upgrade=2
feet=jungle_assassins_footpads,id=124252,bonus_id=567,upgrade=2
finger1=nithramus_the_allseer,id=124635,bonus_id=641/649,enchant=50mastery
finger2=whispering_taladite_ring,id=115798,bonus_id=63/540/618,upgrade=2,enchant=50mastery
trinket1=desecrated_shadowmoon_insignia,id=124228,bonus_id=40/567,upgrade=2
trinket2=seed_of_creation,id=124514,bonus_id=564/566,upgrade=2,gems=75mastery
main_hand=mindscythe_of_the_legion,id=124369,bonus_id=42/567,upgrade=2,enchant=mark_of_bleeding_hollow
off_hand=thumping_demonheart_fetish,id=124206,bonus_id=566,upgrade=2

# Gear Summary
# gear_ilvl=735.69
# gear_stamina=6636
# gear_intellect=4422
# gear_spell_power=2664
# gear_crit_rating=1150
# gear_haste_rating=1433
# gear_mastery_rating=3293
# gear_multistrike_rating=771
# gear_versatility_rating=228
# gear_speed_rating=263
# gear_avoidance_rating=182
# gear_armor=1415
# set_bonus=tier18_2pc=1
# set_bonus=tier18_4pc=1

Simulation & Raid Information

Iterations: 10006
Threads: 7
Confidence: 95.00%
Fight Length: 306 - 606 ( 450.9 )

Performance:
Total Events Processed: 73423566
Max Event Queue: 76
Sim Seconds: 4511453
CPU Seconds: 41.2935
Physical Seconds: 8.1546
Speed Up: 109253

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )
DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Kautokeino Kautokeino berserking 26297 0 0 0.40 0 0 3.0 3.0 0.0% 0.0% 0.0% 0.0% 188.44sec 0 450.87sec
Kautokeino Kautokeino celestial_alignment 112071 0 0 0.40 0 0 3.0 3.0 17.1% 0.0% 0.0% 0.0% 188.44sec 0 450.87sec
Kautokeino Kautokeino draenic_intellect_potion 156426 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 450.87sec
Kautokeino Kautokeino incarnation 102560 0 0 0.40 0 0 3.0 3.0 17.4% 0.0% 0.0% 0.0% 188.40sec 0 450.87sec
Kautokeino Kautokeino moonfire 8921 373507 828 1.71 22522 44953 12.7 12.8 17.7% 0.0% 0.0% 0.0% 36.33sec 4209568 450.87sec
Kautokeino Kautokeino moonfire ticks -8921 3836061 8525 37.52 10555 21086 12.7 281.4 17.4% 0.0% 0.0% 0.0% 36.33sec 4209568 450.87sec
Kautokeino Kautokeino moonkin_form 24858 0 0 0.13 0 0 1.0 1.0 17.6% 0.0% 0.0% 0.0% 0.00sec 0 450.87sec
Kautokeino Kautokeino nithramus 187625 4347179 9642 0.55 1054615 0 4.1 4.1 0.0% 0.0% 0.0% 0.0% 120.84sec 4347179 450.87sec
Kautokeino Kautokeino starfall 48505 0 0 5.92 0 0 44.5 44.5 0.0% 0.0% 0.0% 0.0% 10.22sec 0 450.87sec
Kautokeino Kautokeino starfall_pulse ticks -50288 3758301 8352 0.00 8294 16585 351.9 0.0 17.5% 0.0% 0.0% 0.0% 1.27sec 3758301 450.87sec
Kautokeino Kautokeino starfire 2912 12665194 28090 12.92 100952 201654 97.1 97.1 17.5% 0.0% 0.0% 0.0% 4.64sec 12665194 450.87sec
Kautokeino Kautokeino starsurge 78674 6996495 15518 6.55 110025 219569 49.3 49.3 17.5% 0.0% 0.0% 0.0% 9.25sec 6996495 450.87sec
Kautokeino Kautokeino sunfire 93402 686736 1523 3.15 22413 44850 19.0 23.7 17.5% 0.0% 0.0% 0.0% 22.37sec 4426892 450.87sec
Kautokeino Kautokeino sunfire ticks -93402 3740155 8311 37.46 10300 20643 19.0 281.0 17.5% 0.0% 0.0% 0.0% 22.37sec 4426892 450.87sec
Kautokeino Kautokeino wrath 5176 7587580 16829 14.01 55796 111651 105.7 105.3 17.4% 0.0% 0.0% 0.0% 4.02sec 7587580 450.87sec
Kautokeino Kautokeino_fey_moonwing fey_missile 188046 3109496 9538 83.39 5313 10624 455.1 453.1 17.4% 0.0% 0.0% 0.0% 0.95sec 3109496 326.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

DPS Taken Timeline Chart
DPS Timeline Chart

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Fluffy_Pillow 0
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit%
Fluffy_Pillow 0
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 10.79% 10.79% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:10.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.40% 11.40% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.01% 11.01% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.01%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.67% 11.67% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.75% 10.75% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.75%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.64% 10.64% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.64%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.19% 11.19% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.19%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 12.99% 12.99% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:12.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.22% 6.22% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.22%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 3.36% 3.36% 0.0(0.0)

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:3.36%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.00%
haste

Buff details

  • buff initial source:
  • cooldown name:buff_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • haste_1:100.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
multistrike

Buff details

  • buff initial source:
  • cooldown name:buff_multistrike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • multistrike_1:100.00%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.00%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.00%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.00%
versatility

Buff details

  • buff initial source:
  • cooldown name:buff_versatility
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03

Stack Uptimes

  • versatility_1:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 104302.16
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 11719
death count pct 117.12
avg death time 450.02
min death time 305.85
max death time 605.69
dmg taken 47100703.99

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 450.87
Minimum 305.85
Maximum 605.69
Spread ( max - min ) 299.84
Range [ ( max - min ) / 2 * 100% ] 33.25%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 104863.31
Minimum 91041.99
Maximum 125488.31
Spread ( max - min ) 34446.32
Range [ ( max - min ) / 2 * 100% ] 16.42%
Standard Deviation 4677.4358
5th Percentile 97459.79
95th Percentile 112945.06
( 95th Percentile - 5th Percentile ) 15485.27
Mean Distribution
Standard Deviation 46.7767
95.00% Confidence Intervall ( 104771.63 - 104954.99 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7643
0.1 Scale Factor Error with Delta=300 186766
0.05 Scale Factor Error with Delta=300 747066
0.01 Scale Factor Error with Delta=300 18676665
Distribution Chart
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 1441
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 56492934 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Multistrike 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1938 1938 1938
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=103
race=humanoid
role=tank
position=front
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

actions.precombat=snapshot_stats


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.